PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_21286_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family CPP
Protein Properties Length: 553aa    MW: 60944.7 Da    PI: 6.2983
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_21286_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.21.1e-15333371341
             TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                     +k+CnCkk++Clk+YC+Cfaag +C+e C C++C+N+ e
  Neem_21286_f_1 333 CKRCNCKKTRCLKLYCDCFAAGIYCAEPCACQGCFNRPE 371
                     79**********************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.4E-16331372IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163416.093332395IPR005172CRC domain
PfamPF036381.6E-11334369IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 553 aa     Download sequence    Send to blast
NTNTLQSSVS GRTDSQETLS KFDDKNDRVS KVDVAVDIFR EAEDNIHGKA TRDIKTNEQI  60
EFNSSLDYAS KKQQSENSSA QNAGSAPRGE SDCPLQLLSE PLQTLQTYND SLENAGVIAH  120
GPDDNAMHDL EASKQQRGMS RRCLQFAEAQ PKATVDGTNP SIKSNDATSA RSSPSLVESE  180
SLDSSYVDLN AASGKRQPTN LPQPTTPMFP PRYTGRSPLT VSKPSGIGLH LNSIVNALPK  240
GGGAIVGVKL ASAEHEILEN KASISVSSLI SESFDDTVSL NWLPQVDHNT TPHIKRKFNS  300
EQTDSFEEFC PLSPKRKRQT LKKSSSTVDG DGCKRCNCKK TRCLKLYCDC FAAGIYCAEP  360
CACQGCFNRP EYEDTVLETR QQIESRNPLA FAPKIVQRVA EFVVNIGLLY PLSSVSFIIF  420
FSDFLLFNLA ILAVFACYRM MATILPHPQV GTKEAATAKS HSVLKSIVNA IRLMLDVQVD  480
VDVRVVKICM ARRKQQTNEE YVGNEEIMSN RAISEGTSDA KLEMVINKRD FLHAELYDPH  540
NLTPLTPSFQ CLE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006483326.10.0PREDICTED: CRC domain-containing protein TSO1 isoform X1
TrEMBLA0A067FE470.0A0A067FE47_CITSI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM151961015
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.11e-34Tesmin/TSO1-like CXC domain-containing protein